PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_19862A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 272aa    MW: 29599.6 Da    PI: 4.5074
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_19862AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding248.9e-081435122
                               TSSS-HHHHHHHHHHHHHTTTT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg 22
                               rg+W+ eEd++lv +++q+G +
  Oropetium_20150105_19862A 14 RGAWSSEEDQRLVAYIRQHGHP 35
                               89******************88 PP

2Myb_DNA-binding48.42.2e-1570111447
                                S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +T++E++l+v+++++lG++ W++Ia+ ++ gRt++++k+ w+++
  Oropetium_20150105_19862A  70 FTADEEDLIVRLHQELGNR-WSAIAAQLP-GRTDNEIKNVWHTH 111
                                9******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-7536IPR009057Homeodomain-like
PROSITE profilePS5129417.56162116IPR017930Myb domain
SMARTSM007171.2E-1166114IPR001005SANT/Myb domain
SuperFamilySSF466894.31E-1369117IPR009057Homeodomain-like
CDDcd001671.58E-1070112No hitNo description
Gene3DG3DSA:1.10.10.603.9E-2170113IPR009057Homeodomain-like
PfamPF002496.7E-1470111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGRAPCCAKE GLRRGAWSSE EDQRLVAYIR QHGHPNXXXX XXXXXXXXXX XXXXXXXXXX  60
XXXXXXXXXF TADEEDLIVR LHQELGNRWS AIAAQLPGRT DNEIKNVWHT HIKKRLKDAD  120
SAGRTKQARK SSKPAKTSEK AEDDAGVDHG DELSPFAVAS PGLSSSVSSG VTCSTATEST  180
AAAVSSADNA ATTSASPLAA VKVEETESFS TAEFPPIDES FWTSAEVMDM DLGAMDEELG  240
LASSASTRDE DMEFWLKMLL ESGDMRDLSV L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-121211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794081e-125HF679408.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB2 protein.
GenBankJQ2554781e-125JQ255478.1 Saccharum hybrid cultivar Co 86032 MYB46 (MYB46) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982863.11e-101PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0A9PE011e-103A0A0A9PE01_ARUDO; Uncharacterized protein
STRINGSi040527m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-40myb domain protein 15